DPCstruct | MC5618
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 200 ± 23 aa |
| Standard deviation of domain lengths | 22.63 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 90.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 31.94 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A388K7X9 | 683-877 | LCTCSKDQLPRVEGHVLMRNAQCPLAPTFMHNGKNILQSDVGVKPMEVQRAVGRSMGRSTRAVMRRDLYQVADADCFQEIISDRIEA… |
| A0A388K263 | 314-528 | CAGFPYPRMGGHVQCRLQELDEVHPLLCNANNAPKQNHPERAKLLMREVSDGVNDWSNFQGVPLVIREDRVAKCLTAAPVLKSKCLE… |
| A0A388LC05 | 531-740 | None |
| A0A388L6T5 | 209-414 | None |
| A0A388KXZ5 | 196-374 | None |
| A0A388KSZ6 | 160-342 | None |
| A0A388KQJ3 | 396-629 | None |
| A0A388LI22 | 530-708 | None |
| A0A388ME98 | 117-328 | None |
| A0A388LNZ5 | 283-504 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.