DPCstruct | MC56165
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 81 ± 9 aa |
| Standard deviation of domain lengths | 9.42 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 90.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 44.00 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0357 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I7WV58 | 65-133 | MISRDHADIIGVKGANGRIEKYHINDRSLNGTYINDQRVNSTMQIMEGDVIKFGHMNGAAVKPGQTAPQ |
| A0A0B2VCP3 | 1-85 | MISRIHSTIEAKQDKDRIVYILTDQSLNGTYINDYRAKGPTELKPGDIIKFGHVNGAAIRAGCHGPQHSAEFTFIDTQLNSASIE |
| A0A068Y3Y0 | 1-89 | None |
| V4A1D2 | 59-138 | None |
| A0A183KKQ5 | 67-152 | None |
| A0A4X3PCU8 | 49-143 | None |
| A0A6S7GXE6 | 59-145 | None |
| A0A564Z8G8 | 1-72 | None |
| A0A564Z716 | 67-142 | None |
| A0A1S3HEF7 | 1-64 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.