DPCstruct | MC56162
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 125 ± 14 aa |
| Standard deviation of domain lengths | 13.72 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 74.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 40.12 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0B2V8N0 | 15-121 | ALAIAQYYDPTTRDYTELCTEFAEIAQDKYCQLFDMCCERNANNKLNGDKCQFADSSNGCLLTPEGGIEMLRCKAYNCTPEVTTTTT… |
| A0A2G5THD9 | 3-114 | SRLVYAVAILAVFASAQSEDEWDGTIRDQTEFCGTMAQYAPNGEIYCQQFTMCCDRQFDPNNGDRCQIKESDCSPTDDGRTGLGVCK… |
| A0A0K0E7E8 | 5-142 | None |
| A0A044RJY2 | 1-111 | None |
| A0A1I7RT46 | 17-161 | None |
| A0A4U5NZ90 | 25-152 | None |
| A0A016UW07 | 1-135 | None |
| A0A1I8EDV3 | 2-132 | None |
| A0A7E4VBP5 | 1-133 | None |
| A0A7I8X5D0 | 100-202 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.