DPCstruct | MC56160
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 201 ± 18 aa |
| Standard deviation of domain lengths | 18.25 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 66.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.78 |
| Mean length-normalized TM-Score | 0.29 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 27.40 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0265 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1A8PG74 | 115-326 | MMETGQSFDESEEEEEELLLLSEEEMNKLGSKLIKAEMMGNTAMIEKLKSQLEAAHKAKENHAARIKQHETAESKKAAGHSSEDQEV… |
| A0A0B2V0Q4 | 7-198 | FRRPDEDVDYGNRVVHAKPIDERFRRKLGSLGAGKDFVMGSEKSQKELCGNRNFEEVSSCSGVLSQDERNKISAKILKAEMKGNKEL… |
| A0A6G0V7Y5 | 1-189 | None |
| H3DYL0 | 1-204 | None |
| A0A484AWZ6 | 198-428 | None |
| A0A0B1TGY0 | 1-197 | None |
| A0A498N6J4 | 255-491 | None |
| A0A4C1TP65 | 37-235 | None |
| A0A2R8QDW1 | 334-527 | None |
| A0A368GXG9 | 1-171 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.