DPCstruct | MC5616
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 302 ± 26 aa |
| Standard deviation of domain lengths | 25.73 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 74.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 35.14 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A388LTK8 | 119-399 | HNAQEWHVDDAFDIGDARAKKWQNFPRASMGKACEKAFVKQTLENQYSKGWSNKLRGYMNLATSTDVVWSLVERFFAIFEEGKLPIG… |
| A0A388M5K4 | 14-311 | SFSSSVRQIKTFWDKRNDRIRPLGTVSPNDVEGMKRKKKWETFMNGACKMTPDSGLMNSSLENDYCKDWTNKMRGYMNLAQCGEMVW… |
| A0A388KJW3 | 355-648 | None |
| A0A388KSX7 | 474-784 | None |
| A0A388L239 | 270-584 | None |
| A0A388L6D8 | 3-269 | None |
| A0A388LIK0 | 308-635 | None |
| A0A388LL91 | 277-586 | None |
| A0A388LD04 | 610-919 | None |
| A0A388KGH1 | 200-506 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.