DPCstruct | MC56159
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 168 ± 11 aa |
| Standard deviation of domain lengths | 10.73 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 70.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.52 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 33.46 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7I4K5T2 | 6-158 | GEDTEQLSDVTDPDIYSTRSSAAKSRDGSSSRFFIWFRRVYPLMRNKKVRYLTIINTILLLINFVMLLFMLALLLNQIILAFRISSI… |
| A0A0B2UZE4 | 1-156 | MVSFKEEEESRVVPSVAVVEEPTVVEDVVKAALVTGEESEQRIAPLIRNRKVRMLTILNFFLTLIALLLFFTVILLFAVVVVMKQQV… |
| A0A1I8EZS0 | 148-318 | None |
| A0A183H0E5 | 157-329 | None |
| A0A0R3QRG3 | 42-209 | None |
| A0A0R3RWR7 | 1-185 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.