DPCstruct | MC56158
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 107 ± 9 aa |
| Standard deviation of domain lengths | 8.68 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 89.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 51.23 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0B1TE95 | 1-107 | MLGVVWPDHHVAFPDFLDATNYTAKWWISEIVKDQKNLGYDGIWIDMNEPANFGTNEEHPWYFDDPTHYNATALKCPATEEGKDAEW… |
| A0A0B2V4I5 | 68-179 | MLGVVMQDNHTAFPDFLEKRNTTWKWWSDEIKYFYVNYLKFDGIWINKNEPNVFGTNEEHPDYFDNPDHPNIAPLQCPLTGPDSRFD… |
| A0A0M3IU08 | 272-376 | None |
| A0A0M3IL07 | 1-117 | None |
| A0A0M3ILY6 | 110-205 | None |
| A0A2G9UXG0 | 1-121 | None |
| A0A183DYM7 | 1-108 | None |
| A0A3P7K6M5 | 105-197 | None |
| A0A3P6R2W8 | 56-156 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.