DPCstruct | MC56155
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 162 ± 29 aa |
| Standard deviation of domain lengths | 28.70 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 76.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 18.43 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0V0J5R0 | 32-156 | GSRWIIYGRVSVTYVLGDGALIFGAGLYSNELRTFDLFSPFTHTPLDLSVSLGSTILNQFPTDELQSRLSKVFGPESESLLLTVIEK… |
| A0A183GHE6 | 1-230 | MTKRKRNHSAPPSSAREGLSAQTFPCSSSGLVVMLFFPGDRYCFYGTARVQCLGGDFFVDDFKMPTGGNLELESMRHVCAPYRLSRP… |
| G3I4T6 | 5-134 | None |
| A0A5N5QSJ4 | 535-677 | None |
| E3M674 | 6-176 | None |
| A0A183QQP2 | 19-232 | None |
| A0A151WKZ8 | 287-438 | None |
| A0A7J8KDE1 | 8-139 | None |
| A0A369S8U2 | 14-151 | None |
| A0A4W5MJX5 | 1-117 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.