DPCstruct | MC56154
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 251 ± 28 aa |
| Standard deviation of domain lengths | 27.97 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 71.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.69 |
| Mean length-normalized TM-Score | 0.26 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 25.57 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0P7Y0T9 | 1-239 | MGRPTSVFDLLDSKDKERLEGIRRSAEERKTVTFAPEESRGAIVTASTAPAATTFSRNALSSRFQPPDSERLLSAWRSPTADTAQPF… |
| A0A2C5XIH4 | 110-369 | APPPVPAGWKSAKSATTSAAGTQYVSTADAAKASKLNPTSRAALLGEAPLPGKSVFDYLSESARDKLMAASGRSDLPRAGGEAPAQE… |
| A0A7R9JMG2 | 1-216 | None |
| A0A6V7XTP4 | 1-213 | None |
| A0A224YTE0 | 326-588 | None |
| A0A4S8UL50 | 1-269 | None |
| A0A4C1T6F4 | 11-307 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.