DPCstruct | MC56153
Metacluster Properties and Pfam Annotations
| Number of structural domains | 118 |
|---|---|
| Mean domain length (aa) | 73 ± 8 aa |
| Standard deviation of domain lengths | 8.47 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 89.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 44.16 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0040 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N8KA92 | 92-157 | VTEIFDEVAEAHLIQPTFITEYPAEVSPLARRNDVNPEITDRFEFFIGGREIGNGFSELNDAEDQA |
| A0A0B2UIU5 | 553-625 | ARLLDKLVGEYLESTFISPTFLVGHPQIMSPLAKWHRNVPGLTERFELFAVTKEIANAYTELNDPLTQRQRFE |
| C4JVN1 | 270-347 | None |
| A0A1V5R1N1 | 623-688 | None |
| A0A7I4DH14 | 91-163 | None |
| A0A806DJH1 | 106-193 | None |
| M7Z141 | 470-544 | None |
| A0A5Q5GEV7 | 13-71 | None |
| A0A7C7RWL1 | 72-148 | None |
| K5W6S8 | 238-348 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.