DPCstruct | MC5615
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 254 ± 31 aa |
| Standard deviation of domain lengths | 31.26 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 84.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 21.75 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A836CQZ9 | 5-248 | EEKEAQVAAWLKKIFGDHPIPQYEVNARTTEILYNLSERNRVRDRDVYLVTEDLKQKAKEYESEAKHLQDLLMESVNFSPASLSSTG… |
| A0A388LPL4 | 28-272 | DPQQFAEVKTWLQEVFHLVGREVPSFEYTPRTIAELHRISTMSRRRTKIADIMAKDLRERSGEFRREAVRLKELLNGIGLGQENFSQ… |
| A0A3Q3WV80 | 1-244 | None |
| A0A507CVA9 | 1-237 | None |
| A0A1Y1Y747 | 111-365 | None |
| A0A2Z6MEZ0 | 1-225 | None |
| A0A077WP92 | 3-277 | None |
| A0A6P3Z3C4 | 1-233 | None |
| A3KNB7 | 2-252 | None |
| A0A7M5XCH6 | 30-309 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.