DPCstruct | MC56148
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 254 ± 47 aa |
| Standard deviation of domain lengths | 46.99 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 80.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 18.63 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2Z6NVF4 | 57-325 | TTLVPGFRNSVEEALHGIGIRPHFVSLPSQAQEHRIVISDLPEFEWPSILTMFGYYILVLFKIDSELFGTGSYPYSPLAKRVDELKA… |
| A0A4D6KZB5 | 56-331 | FGLSMRSAMVTENPYVAAGCVLSMLSRSWATLGPCIGETCAEKGIRFIRVKVPSQAERFIVNIDHSKKFTRSEILIYHGYFILLILK… |
| A0A5J5C4L1 | 99-355 | None |
| A0A2J6JWL3 | 27-196 | None |
| A0A0A0L6A6 | 2-183 | None |
| A0A0V0W3I9 | 516-812 | None |
| G7IL20 | 56-209 | None |
| G7IL18 | 38-253 | None |
| G7IL00 | 53-333 | None |
| A0A5S6QLL8 | 22-250 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.