DPCstruct | MC56144
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 71 ± 12 aa |
| Standard deviation of domain lengths | 12.21 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 86.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 81.51 |
| Pfam Score | 98.39 |
| Assigned Pfam label(s) | PF00223- PF00124 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2Z6NDH3 | 1-58 | MSALGCPQDMFSDTAIQLQPVFAQWIQNTHTLAPCTTAPGATESTSLTWGGGDLVAVA |
| A0A287J4K2 | 1-65 | MSALGRPQDMFLDTAIQLQPIFAQWVQNIHATAPGVTTPGATTSTSLTWGGGELVALGGKVALLP |
| A0A835HD36 | 152-225 | None |
| A0A2G3ASJ4 | 104-177 | None |
| A0A3B6PKD4 | 372-467 | None |
| A0A1R3KZH4 | 50-123 | None |
| A0A2G3CMI3 | 165-224 | None |
| A0A5N6P8X7 | 1-60 | None |
| A0A5D2KKH8 | 327-400 | None |
| A0A7J9LF24 | 1-54 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.