DPCstruct | MC5614
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 127 ± 12 aa |
| Standard deviation of domain lengths | 12.38 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 82.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 33.24 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A388KZ69 | 113-250 | MDIQVAVRGRVLGCTITCYEMRDRRGEDDGRVYDFVKPTTSREVRQYEVDADGQTVLYASLCLGFEDDVLCEAVGHVAKVGRAIPNR… |
| A0A388LPG5 | 4-139 | VEEVVWEIVGGKTVVVQETKVDRRCHPCGRMDFSPDTADLHSPVYYVIVEGTLAMKIDGGFEYNKEGNLVDVILNVKKLSEVVPDEW… |
| A0A388KBW1 | 1-144 | None |
| A0A388LBU2 | 302-429 | None |
| A0A388L1S0 | 12-147 | None |
| A0A388KZH4 | 43-165 | None |
| A0A388KX15 | 46-183 | None |
| A0A388KU22 | 629-726 | None |
| A0A388KSN7 | 382-513 | None |
| A0A388KII3 | 146-289 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.