DPCstruct | MC56138
Metacluster Properties and Pfam Annotations
| Number of structural domains | 102 |
|---|---|
| Mean domain length (aa) | 227 ± 51 aa |
| Standard deviation of domain lengths | 51.22 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 86.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 15.27 |
| Pfam Score | 57.69 |
| Assigned Pfam label(s) | PF05076- PF14081- PF13218- PF14080 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2F0AR64 | 22-220 | LHTEVKGPDRDFAEDFVFVGQRAQVLDDSDIEQIRKHTHLIHAGVVFDGETRSWAQKAAQFAMDAVHGGATGVFVETACKTFTKKAL… |
| A0A6P2D120 | 83-321 | NGYLPKILLCLVGGADFPAKAQPILDELGLQYEFAPRDERMAKAFESSSFRVSPTLKPADFARIAQHESVLYVFSKNFSAREAPNVS… |
| Q08QE5 | 18-278 | None |
| A0A2Z6IBK4 | 45-299 | None |
| A0A2L1U572 | 2-151 | None |
| A0A2G4GVV4 | 6-188 | None |
| A0A1W9GCI0 | 17-246 | None |
| A0A3A0CG06 | 345-609 | None |
| A0A6J4L4K4 | 90-350 | None |
| A0A2T0KPW1 | 17-146 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.