DPCstruct | MC56137
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 186 ± 43 aa |
| Standard deviation of domain lengths | 43.19 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 87.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 28.41 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2F0AQC4 | 16-212 | WIMKAFSCSLLLCIALACSKSDDPCKRTDDCKAKGLCVSLQGRCVSVTKDHCLQSTACSENGLCSVLDGRCAAVDEADCRLHSQICA… |
| A0A1V5X3P5 | 31-132 | CAFSEGCKESGLCTTASGACIAGSVDECRKSEDCERKGRCHLSAERCVAGTDHDCRRSVWCKERGMCSLEGEDCIANSDEDCRQSEK… |
| A0A6N2D234 | 4-246 | None |
| A0A2E9R3P1 | 136-328 | None |
| A0A2E7ZU58 | 2-135 | None |
| A0A2E8RVB5 | 38-239 | None |
| A0A2E8RVU1 | 240-406 | None |
| A0A2E8S0Z0 | 157-370 | None |
| A0A2F0AS25 | 277-413 | None |
| A0A2F0AQ18 | 4-151 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.