DPCstruct | MC56136
Metacluster Properties and Pfam Annotations
| Number of structural domains | 1426 |
|---|---|
| Mean domain length (aa) | 124 ± 28 aa |
| Standard deviation of domain lengths | 28.44 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 88.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.48 |
| Mean intra-cluster sequence similarity (%) | 22.07 |
| Pfam Score | 98.77 |
| Assigned Pfam label(s) | CL0505- CL0033- PF01466- CL0015- CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D5YJN1 | 526-673 | GADLTAANLTGADLGGADLSNAHLEDADLTDAWLKYADLREANLEHANLAEADLEGAHLTGAHLKYANLTEANLYGADLTDADLDDA… |
| A0A2E8RZY0 | 13-129 | SANLQGANLTNANLYRANLFNADLTGANLENADLTEAKLEGAWLEGADLQNANLEGAWLVSAVLVNADLTNANLFNANLADADLRWA… |
| A0A354XNK4 | 18-129 | None |
| L8M7M4 | 591-721 | None |
| L8LUA3 | 22-155 | None |
| A0A5D0NTD3 | 11-176 | None |
| A0A7U6KFL1 | 125-211 | None |
| A0A0D8XDL1 | 122-270 | None |
| A0A820CSP4 | 124-274 | None |
| A0A1Y6BKM0 | 286-363 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.