DPCstruct | MC56131
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 124 ± 19 aa |
| Standard deviation of domain lengths | 18.66 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 92.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 33.39 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0125 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Z2H2V2 | 2-110 | TRVFRVVSVCLGSPPETICWEYRDKEKAFHRLGPLTPRDFYQEHVKPLYNIHDKVCLVNDPRPQNPYAKLYSVEFLGNMVGGRPTQY… |
| A0A7Z7D4X9 | 3-112 | QEFAKSKNINKVKALKENALEDVYNILVKSLGKPPKTFKFEYLDKDKKYVSLEEMTPVKFYEKYLSDYVDSKVNLVADPRNKFPHNS… |
| A0A1V9ZE63 | 78-197 | None |
| A0A6F9CGG2 | 148-302 | None |
| A0A2H9TGW3 | 258-373 | None |
| A0A818PI99 | 203-325 | None |
| A0A2A7R971 | 17-124 | None |
| X6PD93 | 38-189 | None |
| A0A5N6KV99 | 752-933 | None |
| A9UPL3 | 204-316 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.