DPCstruct | MC56130
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 89 ± 5 aa |
| Standard deviation of domain lengths | 4.90 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 93.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 50.45 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0088 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B4D6X8 | 46-126 | DHPFATFTEFPADFVAAISRDAKVEFLGNYARSGTTILEELGSEHLRTGKPILYTSADSVLQIAAHEQVIPRKRLYEICRI |
| A0A7Z7D4X8 | 1-89 | MGIYTETPNPQFTEKGFPEDLVAELSKAFDGRKIIGNRNASGTVILAELGHQHMEKGDMIIYTSPDSTLQIIGDEKTLGVDKLTEYA… |
| A0A3S4NEJ6 | 17-114 | None |
| A0A377E329 | 36-121 | None |
| A0A7T9C6G9 | 2-88 | None |
| H6CPG6 | 1-86 | None |
| A0A3D2CNY1 | 90-179 | None |
| A0A7E4RZW9 | 734-826 | None |
| A0A2X3F2U5 | 111-196 | None |
| A0A4Q3VBM5 | 164-254 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.