DPCstruct | MC5613
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 185 ± 23 aa |
| Standard deviation of domain lengths | 22.62 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 77.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 26.59 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A388K8W8 | 259-421 | APRSCDHILQQTLFGNRLIISTQGDPFPWQDCLGSFGRQWLTCGIYRVVDLWDLNTGTWKLEVDILNQLRHQPAKEERLHQIKTAIP… |
| A0A388KPB4 | 287-466 | QQPLFDNPMILDAEGRPFPWMRTKGAFGRAWVTTGIGRVADIWDESTGDWKDDSLMIDALRGQTDKLGRLRHIQRAIPEEWTKMLRM… |
| A0A388LEL8 | 284-474 | None |
| A0A388LDB9 | 603-819 | None |
| A0A388K5U3 | 370-546 | None |
| A0A388MAJ9 | 503-689 | None |
| A0A388M1S2 | 1009-1231 | None |
| A0A388LMA1 | 550-732 | None |
| A0A388K445 | 469-614 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.