DPCstruct | MC56126
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 369 ± 31 aa |
| Standard deviation of domain lengths | 31.49 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 90.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 27.08 |
| Pfam Score | 91.67 |
| Assigned Pfam label(s) | PF21074- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C8DPU6 | 1-396 | QAISMVESQAPAMLEVHARLMDKLSHEGRLDRKIECLPNYEEVEERKVRGEGLFRPELAVVFAYSKLLLKDLMSNSFIVKDSAFKQD… |
| X7ZGJ9 | 2-295 | LESMTDEVAELVLTDNADQNDLMGTSRANAASLLNVHARQIKQLVAERGLSRELEALPSEKEIRRRAEAGIGLTSPELATLMAHVKL… |
| A0A858Q8P5 | 734-1122 | None |
| A0A800AS75 | 247-621 | None |
| A0A534BXF7 | 45-432 | None |
| A0A7V0RKR7 | 332-715 | None |
| A0A7Y2YV14 | 841-1235 | None |
| A0A1S4LM15 | 498-825 | None |
| A0A349SAC6 | 241-629 | None |
| A0A539CV76 | 80-400 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.