DPCstruct | MC56107
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 201 ± 15 aa |
| Standard deviation of domain lengths | 15.20 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 89.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 22.29 |
| Pfam Score | 67.27 |
| Assigned Pfam label(s) | CL0110- CL0168 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| X0M2X9 | 1-215 | MSFGNNPRLIEDFAEYTRQQGCGDHILGRALNEYGIRFGQNGGDEKFTWGFNGVVHWKFGFRSENWCTPLLSWHKAHSRDIARYYEL… |
| A0A4S9EAL7 | 78-254 | NHQKEYEDFTEGHWAGDCVLGKALKDSGTSLTRAWPIFQGDDVGNMNYNHQTQWCQPTVSYHHVSPSEIQDLYDFEKAWMRDTANDT… |
| K2SAL4 | 263-459 | None |
| A0A6A6G4Q5 | 577-810 | None |
| A0A1Q5QA05 | 933-1135 | None |
| R4XL66 | 466-674 | None |
| A0A395HT33 | 226-428 | None |
| A0A0F4GUR5 | 598-812 | None |
| A0A6G1ITI8 | 157-336 | None |
| A0A0J9XLN1 | 336-554 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.