DPCstruct | MC56106
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 495 ± 86 aa |
| Standard deviation of domain lengths | 85.96 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 76.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 20.61 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| X0M131 | 90-519 | QKRKDAHTRDAGTKNSTHYNLARKAKKMVMIPLLLQTATLVPPSFLDIAEFSMVCLFRSWYAALFQPHDPQLLGSYSIDHEGCLVFS… |
| A0A6A6XC02 | 67-440 | PVKLLDFTDQHGGPAAVSQTIITGIKAAGLFKILNTDNFTVQDLVDREKCTIIIPSSSKKAGVYARFHRSGSTMTHWKPNTTYGYIG… |
| A0A096PF14 | 115-640 | None |
| A0A163FYE5 | 154-691 | None |
| A0A6A6CEE8 | 425-1005 | None |
| A0A428S647 | 181-568 | None |
| X0MM19 | 1-365 | None |
| A0A0F7ZUJ6 | 155-761 | None |
| W9K4M3 | 163-744 | None |
| A0A0D2D7H9 | 84-607 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.