DPCstruct | MC5610
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 94 ± 10 aa |
| Standard deviation of domain lengths | 10.39 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 83.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 29.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S3F284 | 137-229 | KSTLCMAVLGTRWTWAGIKEFAFLDAGVLKTPWGEGKWGVALRPKGMAECAPPAECLFADFSSAAHHLSFQLPNRFKSLRVGDGEEV… |
| A0A6C0KV58 | 453-529 | EIVNKKYTWKNKNLIITFLDNNKMDAFGKGEYEIIDKNNIIAKFGGKVHDIHFYENYSFFISTRRDDLQIIFGELLL |
| A0A7S2J016 | 7-105 | None |
| A0A0M0K2W9 | 454-555 | None |
| A0A7S2J8K7 | 131-226 | None |
| A0A5B8ME13 | 412-529 | None |
| R1CCB9 | 285-390 | None |
| A0A7S4N4A5 | 3-92 | None |
| A0A7S0HS76 | 283-368 | None |
| A0A7S3TKG0 | 340-432 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.