DPCstruct | MC561
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 115 ± 8 aa |
| Standard deviation of domain lengths | 7.89 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 79.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 31.55 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4P7C3I1 | 1-114 | MELEEAIRIIKSLADGIDPKTGEPFPEDSPYHYPDTVRALFSLLFAINNIHFDNTKIPLARAGQPWSDKEDLFLRRSFENGISIGEL… |
| A0A3D4D5T8 | 1-103 | MQRAKELLTVLADGVDPLTGEVLPDDHVCNKGEIVRALHCAVEELSRRRKKPLPENNGKPWTEELDDELCRLFDGGMKKKDLCTHFG… |
| A0A844GEQ4 | 1-123 | None |
| A0A1V6DYS8 | 17-131 | None |
| A0A829YMS8 | 3-119 | None |
| A0A809R984 | 1-122 | None |
| A0A7T6Z4G5 | 1-119 | None |
| A0A369UIU4 | 10-135 | None |
| A0A2V9PDI2 | 1-114 | None |
| A0A3D1JUH4 | 75-195 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.