DPCstruct | MC5609
Metacluster Properties and Pfam Annotations
| Number of structural domains | 164 |
|---|---|
| Mean domain length (aa) | 184 ± 29 aa |
| Standard deviation of domain lengths | 28.63 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 83.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 35.19 |
| Pfam Score | 54.07 |
| Assigned Pfam label(s) | PF21249- PF00521- PF18053- CL0329- PF16898 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y1UXF0 | 1-208 | KLSDCSSKDPEVSEVFIVEGDSAGGSALQARDSTFQAILPIRGKIINVEKNRLAKVLQNTEIQSLITAIGTGIGDEMDITKARYHRV… |
| A0A6C0KT07 | 416-619 | VDKLDDANDAGTKNSSNCTLILTEGDSAKALAISGLSVVGRGTYGVFPLRGKVMNVKDATATKIAENKEITDIKKIVGLQNGKVYTD… |
| A0A1A9X788 | 298-485 | None |
| A0A7R9PU81 | 2-153 | None |
| A0A2E7C2K8 | 407-562 | None |
| K6DLU8 | 539-739 | None |
| G0UD63 | 377-599 | None |
| A0A6V7PEU7 | 318-490 | None |
| A0A1A9UKL2 | 261-449 | None |
| A0A2U1QN66 | 14-215 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.