DPCstruct | MC56067
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 195 ± 31 aa |
| Standard deviation of domain lengths | 31.07 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 75.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 36.93 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A663ENR0 | 1-125 | PMNGAPRDAAEPAPVWERPWSLEEIRKGSQSWSLASDAGLLHFLQEFSQQTISRTHEIKKQVDGLISETKAADCRLHNVFNDFLMLS… |
| T1JNH9 | 1-198 | MNESGVKEARPWETAWTPDEIRKNSANWTLAGDAGLLNGMEALARTLLMKTQEIQKEVDLLAQETRGTSSRMHNAITDFLMLSNVQF… |
| A0A023FRV1 | 3-204 | None |
| Q552E2 | 8-271 | None |
| A0A1I8HS46 | 629-810 | None |
| A0A834F6P6 | 2-214 | None |
| F1KRL4 | 2-201 | None |
| A7RTN2 | 7-169 | None |
| V3ZL64 | 41-240 | None |
| A0A3F2RDW8 | 35-258 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.