DPCstruct | MC56063
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 91 ± 4 aa |
| Standard deviation of domain lengths | 4.48 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 81.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 34.20 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T1JKF8 | 1-92 | MYLGGRFTVFPNGILHIRDVNAGDGGRHYRCRTQHRLTGEIRLSNTAGRLLITEPQSSVPPRITHSMGMVEAYQGDAVELPCAAQGS… |
| H3C9K4 | 3-88 | VSRFLITSTGALYILDVQMEDGLYNYRCMTRHRYTGETRQSNSARLIVSDPSNSAPHILDGFERREVMASHRVELPCKSGHPAPKY |
| A0A6V7H647 | 38-129 | None |
| A0A182I5H2 | 10-101 | None |
| T1JKQ4 | 1-101 | None |
| A0A1V9XT59 | 1-87 | None |
| A0A7R9CBB0 | 35-121 | None |
| A0A811XBX8 | 570-661 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.