DPCstruct | MC56054
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 164 ± 13 aa |
| Standard deviation of domain lengths | 13.20 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 88.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.74 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 45.51 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0P0Y4J6 | 8-176 | WQEQWWEHYDSSGKAEKWADKWCSLDPNTPLDVGHAHVWHERWGEKYDGCGGSAKYTDKWAERSEGDGWSKWGDKWDEHFDPNGHGV… |
| A0A5J5AK51 | 1-137 | MFNQQDLEKWWEHYDASGQAKKWAHKWCSIDPQTQLEAGHAHVWHERWGEYDRRGGSMKYTDKWAERSEGDGWTKWGDKWDENFDPN… |
| A0A2G5DTW2 | 60-216 | None |
| A0A5J5BGQ0 | 16-179 | None |
| A0A7I4ABH9 | 312-474 | None |
| A0A6P8E3S7 | 183-339 | None |
| C1E8F0 | 125-281 | None |
| A0A388KXT4 | 675-846 | None |
| A0A6A2WLB5 | 253-414 | None |
| A0A7S0WS38 | 130-317 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.