DPCstruct | MC56050
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 281 ± 42 aa |
| Standard deviation of domain lengths | 42.37 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 86.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 24.49 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2M7ZVX8 | 29-290 | PIPAELFNTDQMERYGITLALSHTLRKKTSPTILLSRLSKSESILIESCDCLNTKCVDSFSPAREWLLDNFYLIQEEIQAIRRNLPK… |
| A0A7X6SHY4 | 2-272 | RVKKSFKVITNHYKRLLEMTDNHLFVGITNEWILDNYYLIVEQKPNILEFLKDSRSVKYLTKNVDLYKIVEDILIDNNYRINESIII… |
| A0A1F9NEB3 | 11-346 | None |
| A0A1H3GS05 | 25-247 | None |
| A0A2V8MDE1 | 22-267 | None |
| A0A1D8QV26 | 39-293 | None |
| A0A4R6QLR9 | 20-345 | None |
| A0A485CQ32 | 35-347 | None |
| A0A3S4EDF3 | 3-348 | None |
| W5YU17 | 20-216 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.