DPCstruct | MC56049
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 58 ± 9 aa |
| Standard deviation of domain lengths | 8.71 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 85.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 38.69 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0737 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4U7J8J6 | 8-53 | NSTLICIRRGTESELFDYQLEVGELGFTTDTHKLFIGSDDGNLQLA |
| R7MA71 | 1-76 | MANKIQFKRGLKTNLPSSADVGMPLWCTDTQELYIGTGNGVALVGGTSGSSEPSNTYTKAEIDEMFEDIATLLSEV |
| A0A7X8ESR3 | 1-58 | None |
| A0A5E4M1H9 | 1-64 | None |
| A0A1W1VQV5 | 1-55 | None |
| H5XZT0 | 1-65 | None |
| A0A837KJW7 | 1-60 | None |
| A0A177KI34 | 4-57 | None |
| A0A1R0Z6L8 | 1-46 | None |
| R7MC91 | 1-63 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.