DPCstruct | MC56042
Metacluster Properties and Pfam Annotations
| Number of structural domains | 154 |
|---|---|
| Mean domain length (aa) | 145 ± 24 aa |
| Standard deviation of domain lengths | 23.79 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 76.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 31.63 |
| Pfam Score | 99.61 |
| Assigned Pfam label(s) | PF03195- PF07047 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453FU80 | 1-93 | RCAHECPFAPYFSPHEPHKFAAVHKVFGASNVSKMLLEVPEAERADAASSLVYEANLRLRDPVYGCMGAISMLQQQVNALEAELQAV… |
| A0A287FZC2 | 24-165 | GAASSGAAGTGSPCAACKFLRRKCQPDCVFAPYFPPDNPQKFVHVHRVFGASNVTKLLNELNPYQREDAVNSLAYEADMRLRDPVYG… |
| A0A1U8ES41 | 59-200 | None |
| A0A6A2XKE9 | 1-125 | None |
| A0A4V3WKH2 | 43-171 | None |
| A0A7J0ESS2 | 1-156 | None |
| A0A835A1W2 | 106-256 | None |
| A0A835AN33 | 59-223 | None |
| A0A4S4D171 | 1-147 | None |
| A0A4Y7L6R4 | 5-161 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.