DPCstruct | MC5604
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 55 ± 4 aa |
| Standard deviation of domain lengths | 3.67 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 89.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.63 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 45.43 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D5MSF3 | 4-54 | CRDMSHLKKYANRPSPPYPANECRNKTMTGNDGNTYASIPDKRGRFRWKKS |
| A0A6C0KH93 | 64-121 | KRSPKSKSCSVQTTKKYTGRSSPPYPANECCDQEMMGNDGRLYVSRADKNGRCAWKVV |
| A0A6C0HF04 | 3-53 | None |
| A0A6C0FCI0 | 211-269 | None |
| A0A6C0IGE6 | 5-60 | None |
| A0A6C0I4T1 | 35-86 | None |
| A0A6C0I3I7 | 54-109 | None |
| A0A6C0I242 | 2-57 | None |
| A0A6C0I1U7 | 8-65 | None |
| A0A6C0M2Z5 | 24-80 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.