DPCstruct | MC56038
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 481 ± 119 aa |
| Standard deviation of domain lengths | 119.39 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 71.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 27.17 |
| Pfam Score | 58.24 |
| Assigned Pfam label(s) | CL0020- CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A287FTX9 | 104-611 | LMLRCSLRKYPSSSLVSDCITAMSEGLQMCFYSHFISLLWGDNDPACLSSSSHVDSEWESFSYEISKACARYERTLPTKSSTSSSTA… |
| H1VW97 | 302-719 | HQIQIQLQPRNPQVRKVLDACRSILPATHAEKIFPGWWHIMIWVKSEEFEVADAEWSSLVILLLTIYLALGKTKPAQDPPTKPSRGR… |
| A0A7R8XBV7 | 23-729 | None |
| C1H5G0 | 759-1394 | None |
| A0A1D6M2K7 | 447-971 | None |
| A0A287FTZ3 | 10-509 | None |
| A0A2R8QA59 | 609-1117 | None |
| A0A1I8H9N8 | 11-289 | None |
| A0A833W355 | 496-1104 | None |
| O18191 | 249-813 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.