DPCstruct | MC56037
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 143 ± 15 aa |
| Standard deviation of domain lengths | 14.86 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 81.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 51.24 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A287FF54 | 1-142 | MEAIRKQASKLREQVARQQQAVLKQFGGGYADSVFADEGEAQQHSKLEKLYISTRAAKHFQRDIVRGVEGYIVTGSKQVELGNKLCE… |
| A0A834XAN5 | 1-122 | MDAIRKQASKLREQVARQQQQHQKLEKLYISTRAGKHYQRDIVRGVEGYIVTGSKQVEIGTKLSEDSRKYGAENTCTSGNTLSRAAL… |
| Q8VWF1 | 1-144 | None |
| A0A2Z6MRA7 | 1-140 | None |
| A0A6A3CJA5 | 32-195 | None |
| A0A6S7MHW6 | 1-145 | None |
| A0A287FF61 | 1-144 | None |
| D8R8R0 | 1-166 | None |
| A0A7N0U644 | 1-165 | None |
| A0A6J1AI89 | 1-133 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.