DPCstruct | MC56036
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 200 ± 11 aa |
| Standard deviation of domain lengths | 10.68 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 84.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 53.10 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF16940 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q0IWS0 | 109-295 | VPGVAAAGLHNYVAGSDDPTKLESSEVEAIASKYGVSTEDATFKAELCDLYGRFVFSLIHPGYEDLEGTEVETIIKFKKALGLNDID… |
| A0A287FCA3 | 1-194 | VVPEVAAVGLHNYVAGCDDPTALEASEVAAIASKYGVSTQDAAFKSELCDLYASFVYSVLPPGHEDLKGTEVEAIKKFKKALGLDDV… |
| A0A2P2LUT4 | 1-191 | None |
| Q9FWV4 | 121-332 | None |
| A0A7S0L5T6 | 163-358 | None |
| A0A7J6DYR1 | 34-247 | None |
| A0A452YLF0 | 75-291 | None |
| A0A452YL92 | 77-260 | None |
| A0A836XQM1 | 114-310 | None |
| A0A452YLE7 | 4-210 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.