DPCstruct | MC56032
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 216 ± 21 aa |
| Standard deviation of domain lengths | 20.77 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 69.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.37 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 36.31 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0512 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A287F5P3 | 1-236 | RRFLEKQKGKIAGVIFCITSSSDTEIYKRYLLLPLYFPRDKQEEETAVSKLPADVGDENGETVIDERKIRIRPLPAGAADRTVPAAP… |
| L8YDE6 | 2-181 | ATYQKLLPLYFPRSLKEESRSLPYLPADIGNAEGEPVVPERQIRISEKPGAPEDNQEEEDEGLGVDLSFIGSHAFARMEGDIDKQRK… |
| A0A7J7BZ83 | 220-449 | None |
| A9NUI5 | 109-341 | None |
| U6GS64 | 107-299 | None |
| A0A813UJ16 | 86-302 | None |
| A0A1D6JNV8 | 4-241 | None |
| A0A2D4LQ85 | 191-390 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.