DPCstruct | MC56027
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 328 ± 48 aa |
| Standard deviation of domain lengths | 47.91 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 72.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 34.18 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05782 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A673HU83 | 1-349 | MTQKEDTNFHPENVPIGPRMGPEVDFPAAFPNTGNLQDICQFSKTPVRYPKDMFPQDGFGHKYRQADAINQLQSWYGVCCGINGTQE… |
| A0A6J1VFV4 | 72-321 | GQQLPILVHGEPQAVPLQPRGSGRHCKEVGCTRKPPFYKLEEFPPGRPSLSNLGALCSAGRTKPSYGPWNLPQTSFSHLSRQGEALN… |
| A0A1L8FBW7 | 1-300 | None |
| A0A6P3DYY3 | 122-379 | None |
| A0A836AM15 | 786-1113 | None |
| A0A498M7L3 | 21-295 | None |
| A0A6P6R2U4 | 32-402 | None |
| A0A6P3W080 | 87-448 | None |
| A0A6Q2XM42 | 274-647 | None |
| A0A1S3RZV7 | 1-260 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.