DPCstruct | MC56026
Metacluster Properties and Pfam Annotations
| Number of structural domains | 52 |
|---|---|
| Mean domain length (aa) | 147 ± 35 aa |
| Standard deviation of domain lengths | 35.30 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 91.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 22.39 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10050 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0S7XJN1 | 15-150 | DWVRMKCQFGCGGYGARLTCPPYSPTPDQTRRIIKDYKNALLIHSRNSRKIKEAVPEIERELFLKGFYKAWGMGAGPCRYCHECDIE… |
| A0A846Q5A9 | 16-169 | MDADETRKLLKNYRYALLLRNEAEAEEIVGFEVYEKKPYRAKYSVPLHEVINQLEAEAFYMGYYYALGLKSGPCLLCAKEVYENKGE… |
| A0A174PJ26 | 1-83 | None |
| A0A1X1Q5C8 | 4-128 | None |
| A0A7C4M8X0 | 36-222 | None |
| I4A905 | 194-357 | None |
| A0A7C1SFN2 | 50-196 | None |
| A0A1F8DJW0 | 6-168 | None |
| A0A1F5CVB6 | 28-261 | None |
| A0A7V6VQA9 | 2-166 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.