DPCstruct | MC56023
Metacluster Properties and Pfam Annotations
| Number of structural domains | 126 |
|---|---|
| Mean domain length (aa) | 167 ± 36 aa |
| Standard deviation of domain lengths | 36.11 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 86.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 32.22 |
| Pfam Score | 95.83 |
| Assigned Pfam label(s) | CL0231- PF21186- CL0202 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C5L5K5 | 2-163 | PHRSFTELVGLIEKLRGEDGCPWDGAQTHATLRPYVLEEAYETIAAIDTGDPAAIADELGDLLLQVLLHAQIASKAGEFTIDDVIEN… |
| A5IK56 | 2-115 | VERLLEIIERSLEKCPWLEKQSIETLLEALASEIEEVTEAVKKNDLANLEEEVGDLIYDALLVAAVAQRDYGIDLERAIQKVVEKIS… |
| A0A379ACN2 | 3-144 | None |
| A0A2N6VRA5 | 21-237 | None |
| A0A4Z0IXD0 | 2-129 | None |
| E7GTZ4 | 64-200 | None |
| A0A2N6FGR7 | 36-211 | None |
| A0A437UX62 | 168-368 | None |
| A0A2S5IZ25 | 1-211 | None |
| A0A7C5JR65 | 2-204 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.