DPCstruct | MC56022
Metacluster Properties and Pfam Annotations
| Number of structural domains | 195 |
|---|---|
| Mean domain length (aa) | 127 ± 21 aa |
| Standard deviation of domain lengths | 21.42 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 85.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 23.99 |
| Pfam Score | 94.77 |
| Assigned Pfam label(s) | CL0172- CL0552- CL0684- CL0303 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A662E3P5 | 3-110 | PDGMTVLVGKTAGDNDILSLRLASPRDWWFHTAGESGSHVVVRNPDNLDRLPRETRRFAAALAAGYSKARQGGKVAVHEARARDVSK… |
| A0A7C4NMS7 | 27-149 | EAEEEREEREPPSQPRQYRIGEFTVLVGRSAKENDWIVRRASPNDLWLHARGVPGAHVLIKNGGRTVPEEVLRRAAELAAWFSKARG… |
| G3ILC4 | 166-295 | None |
| A0A2P6NP64 | 2-97 | None |
| A0A6V7TQZ1 | 76-202 | None |
| A0A1F3SKN5 | 302-425 | None |
| A0A6L5C9D9 | 2-113 | None |
| A0A831JZ28 | 227-352 | None |
| A0A0D2MIV3 | 411-542 | None |
| B9HX64 | 35-233 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.