DPCstruct | MC56019
Metacluster Properties and Pfam Annotations
| Number of structural domains | 90 |
|---|---|
| Mean domain length (aa) | 188 ± 33 aa |
| Standard deviation of domain lengths | 32.71 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 89.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 17.96 |
| Pfam Score | 73.81 |
| Assigned Pfam label(s) | CL0167- CL0021 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3R6TXL4 | 4-205 | SVNLTGMVLKATPVGENDRRLVILTRERGKITAFARGAKRPGSQLLGVTRPFVFGTFKLYEGRDAYNLQAADVLNYFSEITMDMEAT… |
| A0A7C2YEQ7 | 17-217 | HAETDRIAVLLTPCGRLDVLAKGARRLERPVGAVLDPLHVVDVIHYRRRGLHLLKEANLVRTFPRVREDLERATAALTALEWVTALV… |
| A0A1E3H294 | 6-188 | None |
| F2LX31 | 3-172 | None |
| A0A6L7WP51 | 2-133 | None |
| A0A2D5BAB8 | 2-220 | None |
| A0A381ICI2 | 4-144 | None |
| A0A7J0BPI5 | 1-161 | None |
| A0A6B2M2S5 | 2-181 | None |
| A0A2W4Z329 | 10-219 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.