DPCstruct | MC56014
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 241 ± 48 aa |
| Standard deviation of domain lengths | 47.74 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 80.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 35.66 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10303 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q0US68 | 10-206 | ANPFQDTYDKLLAIRNKLEKLTLTQAWSLRETDLWDYQRQLDRIDESRVDGNFFDALGRPAEIYEQRVSCADTLLYLLRKSYALVYQ… |
| F8MAX5 | 175-444 | LQDPLQSMHERLISILRSMSLANTKAKFSASEVQRLQAQVKEIDESRVDGNFVGPDGQVLRGSERVSRLVDVCLRWSDIVLERKGVI… |
| A0A0J9UQX3 | 78-293 | None |
| A0A1E5R0W8 | 385-613 | None |
| H0EQP9 | 43-231 | None |
| A0A4U0VI04 | 157-365 | None |
| A0A161HJS2 | 67-295 | None |
| I1BKH2 | 4-188 | None |
| A0A4U0WNR2 | 1-217 | None |
| A0A4P9WUT9 | 204-504 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.