DPCstruct | MC56013
Metacluster Properties and Pfam Annotations
| Number of structural domains | 135 |
|---|---|
| Mean domain length (aa) | 274 ± 43 aa |
| Standard deviation of domain lengths | 42.68 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 87.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 20.21 |
| Pfam Score | 97.20 |
| Assigned Pfam label(s) | CL0044- PF03477- PF11307- PF15686 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A654ZTL8 | 1-251 | MSDDERDYATRLCTQFIAGEEAVTEDIQPFMSAMRAEGRLADEMYLTQFAFEEAKHTQVFRMWLDAVGISEDLHRYLDDLPAYRQIF… |
| A0A315EKB6 | 454-724 | FDWSYEAQASSVQNLYAKSKHAQWDAAERINWQQDLDPENPFGYDDRLMPLSGTEAWAKASSKERANVRHQYQAYMVNQFLHGEQAA… |
| A0A4W6EJ60 | 5-194 | None |
| A0A370H9I4 | 41-279 | None |
| A0A2K6SUK7 | 2-312 | None |
| A0A2S8BHP3 | 8-275 | None |
| A0A3S6Z1Q8 | 4-245 | None |
| P36603 | 73-366 | None |
| A0A183SC55 | 1-258 | None |
| A0A7C8CIJ6 | 37-304 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.