DPCstruct | MC56010
Metacluster Properties and Pfam Annotations
| Number of structural domains | 65 |
|---|---|
| Mean domain length (aa) | 220 ± 41 aa |
| Standard deviation of domain lengths | 40.58 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 77.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 29.74 |
| Pfam Score | 97.92 |
| Assigned Pfam label(s) | CL0016- PF04176- PF11277 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5A8CMB1 | 26-237 | ETIGGWSFRSVSAPIASSARIEEVEAALSLPHGVPVPEACFADNSLTIRHDASGTELRINAVDALRSWHSRQSRIAADAGGVVCATS… |
| A0A5F4CGU3 | 17-228 | PWKLTAAKTHIMKSADVEKLADELHMPSLPEMMFGDNVLRIQHGSGFGIEFNATDALRCVNNYQGMLKVACAEEWQESRTEGEHSKE… |
| A0A0N1IIN3 | 5-299 | None |
| A0A0D0T5F0 | 7-194 | None |
| A0A093XQN1 | 15-241 | None |
| A0A2G5UK67 | 358-522 | None |
| A0A2U1QMD9 | 2-223 | None |
| A0A7J0ET87 | 10-140 | None |
| A0A5F7ZSY3 | 2-143 | None |
| A0A7S1KLA3 | 6-297 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.