DPCstruct | MC56006
Metacluster Properties and Pfam Annotations
| Number of structural domains | 76 |
|---|---|
| Mean domain length (aa) | 294 ± 59 aa |
| Standard deviation of domain lengths | 59.43 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 75.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.38 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 17.75 |
| Pfam Score | 91.58 |
| Assigned Pfam label(s) | CL0123- PF10935 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N6AR07 | 2-282 | TAKPLSRGERWLLGATSVGAVAVGALGLASSFDAVSGAAVRWGFDAPWMLPAGIDLAIPVFTVAHLLLVRMNMALAWVRAVPWALTG… |
| A0A1X0U937 | 52-229 | RTAALATARWGTVALSVISFAISYIALADLAHIAGLGLQAFLWPLMIDGTIVVGTVAVFAAPDAHSWSLLIASAVVSVAGNGIHAAI… |
| A0A7X7NPE6 | 7-371 | None |
| A0A5C8UN15 | 19-244 | None |
| A0A840WUJ4 | 41-285 | None |
| A0A2T0KJ22 | 1-196 | None |
| A0A6G2P4W4 | 11-304 | None |
| A0A6G2PBC0 | 1-284 | None |
| A0A545AUS5 | 3-322 | None |
| A0A3D9WRH2 | 2-269 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.