DPCstruct | MC56004
Metacluster Properties and Pfam Annotations
| Number of structural domains | 156 |
|---|---|
| Mean domain length (aa) | 85 ± 21 aa |
| Standard deviation of domain lengths | 20.70 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 84.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 34.22 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6M1ZXY2 | 10-85 | GSTMARAKKKKRCPFTASGIQEIDYKDVDTLKKFITDRGKILPRRITGVSAWHQKLLSNAIKKARNVALVPFVDRA |
| A0A6P5JF85 | 88-196 | WADYRRNYKGGVPPQRTRKTCIRGNKVAGNPCPICRDRKLHVDFRNVKLLEQFVCAYTGVIFHAPYTGVCMKQHKKLTEAILKARDH… |
| A0A7S0YAM9 | 165-239 | None |
| A0A1A9UCP7 | 183-304 | None |
| A7M919 | 9-79 | None |
| A0A291FI74 | 6-88 | None |
| A0A345HH12 | 63-151 | None |
| A0A396GYF1 | 8-71 | None |
| A0A166BC43 | 3-107 | None |
| A0A0U0W0V5 | 98-178 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.