DPCstruct | MC56
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 115 ± 15 aa |
| Standard deviation of domain lengths | 14.70 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 76.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.50 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 42.16 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J7H2J6 | 207-321 | EKWMNIVMDKLKELLVVLEDFGSSLIAKLDEVFPPDSRGDQLRHWLHVATPFLIAAAVLLIMCLCCRCCCCCSLGRGERMMKAPGRN… |
| A0A161Y386 | 2-94 | VEQMVKDYETRVIQWVDKVFPPGTRADALKHWAQVGAPFLVAWLVLLLLMFCCKCCGRGRSERTMRAPGRNYRMPRREFEGNPGSYF… |
| A0A4D9BP26 | 4-114 | None |
| A0A200QKJ3 | 4-121 | None |
| A0A4U6W284 | 27-157 | None |
| A0A834L4H0 | 33-149 | None |
| A0A7N0UJ52 | 3-83 | None |
| A0A5B7BZW9 | 4-107 | None |
| A0A804ITC4 | 15-142 | None |
| A0A7J6UTK1 | 46-179 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.