DPCstruct | MC55994
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 159 ± 21 aa |
| Standard deviation of domain lengths | 21.45 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 79.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 15.14 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J8EPC8 | 1-138 | MSLRMVFSSSDGVQLYPDNTPDDFRIKLNRTINLDGYWVVALTELSITDFEKSVKKKELYIYSDICRESFTGDTEQPLLRRVYLEND… |
| A0A6C0LGF7 | 6-170 | MSDYKIILIDTENVIYNGSSNNFNFHVNLAEHLKDVYKIKILFDATSILIANLINQTKIKNLDTIYINCNDYDRVRTTIENNNNLSY… |
| A0A6L5D8I1 | 3-126 | None |
| A0A6J8EKI7 | 288-420 | None |
| A0A6J8E8C0 | 7-153 | None |
| A0A1Q3PBL0 | 1-149 | None |
| A0A6C0JIC0 | 15-200 | None |
| A0A381RAE7 | 33-204 | None |
| A0A080ZP29 | 18-163 | None |
| A0A6C0H6V4 | 38-209 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.