DPCstruct | MC55991
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 381 ± 15 aa |
| Standard deviation of domain lengths | 15.06 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 82.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 17.03 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19244 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6C0LAW8 | 1-415 | MSNTGSANKIDKIIRDIEVNKLKNVYNEYNDVIKLISNFIIKKKLILYGGFVINIILPKNLRFYKDYTINDFDCLSKNPLNDSIELA… |
| A0A6C0H1C9 | 8-391 | LYTQYDIDVIGDNIDILMKEADKIKQTEYEPTITEFNNVVKDVEIFIKKKNRIVYGGTALNRLIASKNPKDAFYKEYDRPDIEFYSP… |
| A0A6C0CXR6 | 1-372 | None |
| A0A250XPZ8 | 1-376 | None |
| A0A250XPY8 | 140-516 | None |
| A0A6C0HGJ2 | 2-369 | None |
| A0A2D5VNB2 | 124-498 | None |
| A0A6C0JA73 | 1-363 | None |
| A0A250XNV6 | 467-862 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.